PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00021.210
Common NameAMTR_s00021p00221770, LOC18442320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family ARF
Protein Properties Length: 740aa    MW: 82471.7 Da    PI: 6.3992
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00021.210genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.62.5e-23144244198
                                               EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE- CS
                                        B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvlt 62 
                                               f+k+lt sd++++g +++ +++a+e+       +  ++ +++l+ +d++g +W++k+iyr++++r++lt
  evm_27.model.AmTr_v1.0_scaffold00021.210 144 FCKTLTASDTSTHGGFSVLRNHADEClppldktQ--QPPTQELVAKDLHGIEWRFKHIYRGQPRRHLLT 210
                                               99***************************99643..344559*************************** PP

                                               TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                                        B3  63 kGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                                               +GW+ Fv++++L +gD ++F   + +++el+v+++r
  evm_27.model.AmTr_v1.0_scaffold00021.210 211 TGWSVFVSSKRLVAGDAFIFL--RGDNGELFVGIRR 244
                                               *********************..3489999****97 PP

2Auxin_resp107.21.9e-35270351183
                                Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdl 69 
                                               a +a+s +s F+v+Y+Pr+s+s F++ v+k+++a+++++svGmRfkm+fe+ed serr++Gt++gv d+
  evm_27.model.AmTr_v1.0_scaffold00021.210 270 ATRAISFQSLFTVYYKPRTSPSGFIIGVNKYLEAMNHRLSVGMRFKMKFEGEDTSERRYTGTIIGVGDV 338
                                               5678999************************************************************** PP

                                Auxin_resp  70 dpvrWpnSkWrsLk 83 
                                               +p  W++S+WrsLk
  evm_27.model.AmTr_v1.0_scaffold00021.210 339 SP-GWNDSQWRSLK 351
                                               **.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.57E-42136270IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.5E-40137259IPR015300DNA-binding pseudobarrel domain
CDDcd100172.63E-21142244No hitNo description
PROSITE profilePS5086311.519144246IPR003340B3 DNA binding domain
SMARTSM010191.8E-22144246IPR003340B3 DNA binding domain
PfamPF023621.3E-21144244IPR003340B3 DNA binding domain
PfamPF065072.1E-32270351IPR010525Auxin response factor
SuperFamilySSF542775.17E-11623707No hitNo description
PROSITE profilePS5174525.592629722IPR000270PB1 domain
PfamPF023093.3E-6676714IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 740 aa     Download sequence    Send to blast
MAYAEEFRGA LPQPEQSLGM FPQNLSSECS APGPTNDALY RELWHACAGP LVTIPGEGER  60
VYYFPQGHME QLEVSMNQGV EQQVPLFNLP SKILCRVMQV QLRAEPDNDE VYAQYTLIPE  120
LDQSELSSPD SCPPVPPKPA VRSFCKTLTA SDTSTHGGFS VLRNHADECL PPLDKTQQPP  180
TQELVAKDLH GIEWRFKHIY RGQPRRHLLT TGWSVFVSSK RLVAGDAFIF LRGDNGELFV  240
GIRRLLRQQS TMPSSVISSD SMHLGVLATA TRAISFQSLF TVYYKPRTSP SGFIIGVNKY  300
LEAMNHRLSV GMRFKMKFEG EDTSERRYTG TIIGVGDVSP GWNDSQWRSL KVQWDESSAI  360
RRPDRVSPWE LEPIVSTSPL TTTIQPRNKR ARLPNMPMSR ERSILGGCKN TTDPSSPYWY  420
SSQTTQTSEL NSDTEGESGQ SHILWGQKQM DLKNDALGHS PRPSTENWMN HFSNQTESTL  480
LKSPKLLFQD GEFKPERARS IGSAFSSGEL QSKWAPSMAG HSQTEGSVEP HSDLNRGCLS  540
GMVTKERKPD SNGYRLFGIL IDNNSSHGED SLPQTGKIPA AIEEHPVQAS VNGHSQPADS  600
EDPSRVAIIE GKSSHSSPKD VHKASISTRS CTKVLMQGIG VGRAVDLTKL NGYPDLIKEL  660
EERFDIKGEL QSPNKKWEVV YMDDEGDMML VGDDPWAEFC NMVRKIAIYP CEEVKKMTNR  720
TRLHCSEEPA TPTSEHKTE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B0.03337813359Auxin response factor 1
4ldw_A0.03337813359Auxin response factor 1
4ldv_A0.03337813359Auxin response factor 1
4ldx_B0.03337813359Auxin response factor 1
4ldx_A0.03337813359Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006852604.10.0PREDICTED: auxin response factor 7 isoform X2
SwissprotQ6YVY00.0ARFG_ORYSJ; Auxin response factor 7
TrEMBLW1Q0R40.0W1Q0R4_AMBTC; Auxin response factor
STRINGGLYMA16G00220.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.40.0auxin response factor 1
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]